ALOX15 anticorps (Middle Region)

N° du produit ABIN634401

Cet anticorps anti-ALOX15 est un anticorps Lapin Polyclonal détectant ALOX15 dans WB. Adapté pour Humain.

Aperçu rapide pour ALOX15 anticorps (Middle Region) (ABIN634401)

Antigène: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALOX15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALOX15 anticorps

Épitope: Middle Region

Specificité: ALOX15 antibody was raised against the middle region of ALOX15

Purification: Affinity purified

Immunogène: ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALOX15 Blocking Peptide, (ABIN5612029), is also available for use as a blocking control in assays to test for specificity of this ALOX15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALOX15

Antigène: ALOX15 (Arachidonate 15-Lipoxygenase (ALOX15))

Autre désignation: ALOX15

Sujet: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization